PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G214900.1
Common NamePHAVU_001G214900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 439aa    MW: 49310.3 Da    PI: 9.9063
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G214900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.71.1e-07129170446
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         WT+eE ++l d+++++  + +  Ia +++  Rt +++k+r+++
  Phvul.001G214900.1 129 WTKEETDQLFDLCERFDLR-FVVIADRFPSSRTVEELKDRYYS 170
                         *******************.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162821.2E-30101175IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007176.8E-8125174IPR001005SANT/Myb domain
SuperFamilySSF466891.06E-6125174IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-6128172IPR009057Homeodomain-like
CDDcd116582.39E-19129171No hitNo description
PfamPF054998.4E-6313375IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MDAKDILGLP KNSFPPLEKK SRPPKESQRK PDGISREVYA LTGGLAPLMP AIEASQLKKK  60
TPPLEKITWQ WLPFTNSARK DNLQLYHWVR VVNGVPPTGD YSFAKYNKAV DVIKYTDEEY  120
DKFLTNPMWT KEETDQLFDL CERFDLRFVV IADRFPSSRT VEELKDRYYS VSRAILVARA  180
PSSGDVAAHP LVKELYNVSQ EMERKRALSM VLSQTRQQER RDEEVLVEAK RIAESRIPPK  240
VAEESQLAAS NAGAEATERA VPGETVSPSN VQLPSMVAPS ILSDNASTVA SLRMLRVYLR  300
TYALEQMVQA ANSSAGLRTI KRVEQTLQDL GVNLKPRVPT KAVCAEHLEL RKEILTWLNL  360
QKQVQYKEAE GSSFRDGSYG ETPGTPKHLH RAGDQDRTFV PDAMNFGVER VGKKDQKRKA  420
PGAPSAHKRP RKLKATDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4iej_A4e-20100185493DNA methyltransferase 1-associated protein 1
3hm5_A4e-20100185493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0948860.0BT094886.1 Soybean clone JCVI-FLGm-25A17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163204.10.0hypothetical protein PHAVU_001G214900g
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLV7D0P00.0V7D0P0_PHAVU; Uncharacterized protein
STRINGGLYMA19G40630.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49752330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein